Active Recombinant Human TGFB2, His-tagged
Cat.No. : | TGFB2-22H |
Product Overview : | Recombinant Human TGFB2, expressed in Nicotiana benthamiana. |
- Specification
- Gene Information
- Related Products
Description : | TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological pr centigradeesses as embryogenesis, tissue remodelling and wound healing. |
Source : | Nicotiana benthamiana |
Species : | Human |
Tag : | His |
Form : | Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. |
Bio-activity : | The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50< 40ng/ml, corresponding to a specific activity of 25,000> |
Molecular Mass : | TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. |
Purity : | Greater than 97.0% as determined by SDS-PAGE. |
Unit Definition : | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS. |
Usage : | FOR RESEARCH USE ONLY |
Quality Control Test : | Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TGFB2 Human should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions. |
Warning : | Avoid repeated freeze-thaw cycles. |
Gene Name : | TGFB2 transforming growth factor, beta 2 [ Homo sapiens ] |
Official Symbol : | TGFB2 |
Synonyms : | TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892; |
Gene ID : | 7042 |
mRNA Refseq : | NM_001135599 |
Protein Refseq : | NP_001129071 |
MIM : | 190220 |
UniProt ID : | P61812 |
Chromosome Location : | 1q41 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function : | beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; |
Products Types
◆ Recombinant Protein | ||
TGFB2-5695R | Recombinant Rat TGFB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB2-47H | Active Recombinant Human TGFB2 Protein, Animal Free | +Inquiry |
TGFB2-2181H | Recombinant Human TGFB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB2-1253C | Recombinant Chicken TGFB2 Protein, His-tagged | +Inquiry |
TGFB2-104H | Active Recombinant Human TGFB2 Protein | +Inquiry |
◆ Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket