| Cat.No. : | BFP-2 |
| Product Overview : | The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein |
| Source : | E. coli |
| Tag : | His |
| Form : | Freeze Dried |
| Molecular Mass : | 29.0 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK |
| Endotoxin : | <0.1> |
| Purity : | Purity by SDS-PAGE: ≥97%Purity by HPLC: ≥97% |
| Usage : | For Research Use Only! Not to be used in humans. |
| Reconstitution : | Reconstitute with dH?O to 1 mg/ml |
| Shipping : | Gel pack |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All BFP Products
Download Datasheet