Recombinant Blue Fluorescent Protein (Full length), N-His tagged

Cat.No. : Blue-193
Product Overview : The protein is engineered with 6×His-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Protein Length : Full length
Description : Fluorescent proteins, like EBFP, can be used as protein "tags" to study the subcellular localization of proteins and/or their translocation upon stimulation or as markers for transfection in transient and stable expression systems.
Form : Lyophilized
Molecular Mass : 29 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Endotoxin : < 1.000 Eu/μg
Purity : ≥97% SDS-PAGE
Applications : Functional Studies
Reconstitution : Reconstitute with dH2O to 1 mg/mL
Shipping : Shipped at 4 centigrade. Store at -80 centigrade.
Official Symbol BFP
Synonyms BFP; Blue Fluorescent Protein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BFP Products

Required fields are marked with *

My Review for All BFP Products

Required fields are marked with *

0
cart-icon