Recombinant Blue Fluorescent Protein (Full length), N-His tagged
Cat.No. : | Blue-193 |
Product Overview : | The protein is engineered with 6×His-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
Protein Length : | Full length |
Description : | Fluorescent proteins, like EBFP, can be used as protein "tags" to study the subcellular localization of proteins and/or their translocation upon stimulation or as markers for transfection in transient and stable expression systems. |
Form : | Lyophilized |
Molecular Mass : | 29 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK |
Endotoxin : | < 1.000 Eu/μg |
Purity : | ≥97% SDS-PAGE |
Applications : | Functional Studies |
Reconstitution : | Reconstitute with dH2O to 1 mg/mL |
Shipping : | Shipped at 4 centigrade. Store at -80 centigrade. |
Official Symbol | BFP |
Synonyms | BFP; Blue Fluorescent Protein |
◆ Recombinant Proteins | ||
Blue-193 | Recombinant Blue Fluorescent Protein (Full length), N-His tagged | +Inquiry |
BFP-001E | Recombinant Blue Fluorescent Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BFP Products
Required fields are marked with *
My Review for All BFP Products
Required fields are marked with *
0
Inquiry Basket