Recombinant Blue Fluorescent Protein (Full length), N-His tagged

• Cat.No.: Blue-193
• Product Overview: The protein is engineered with 6×His-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads.

Specification

• Source: E.coli
• Tag: His
• Protein Length: Full length
• Description: Fluorescent proteins, like EBFP, can be used as protein "tags" to study the subcellular localization of proteins and/or their translocation upon stimulation or as markers for transfection in transient and stable expression systems.
• Form: Lyophilized
• Molecular Mass: 29 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Endotoxin: < 1.000 Eu/μg
• Purity: ≥97% SDS-PAGE
• Applications: Functional Studies
• Reconstitution: Reconstitute with dH2O to 1 mg/mL
• Shipping: Shipped at 4 centigrade. Store at -80 centigrade.

Gene Information

• Official Symbol: BFP
• Synonyms: BFP; Blue Fluorescent Protein