Recombinant Blue Fluorescent Protein, His-tagged

Cat.No. : BFP-001E
Product Overview : The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads.
Availability June 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Description : Blue fluorescent protein (BFP) is a mutant of green fluorescent protein (GFP), where the chromophore has been modified to shift the emitted fluorescence into the blue spectral region.
Form : Lyophilized (Freeze Dried)
Molecular Mass : 29.0 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Endotoxin : <0.1 ng/μg
Purity : ≥97%
Applications : The protein is suitable as a control reagent for BFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of BFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of BFP into cells and tissues, etc. The recombinant BFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP, YFP, or any other dyes. The 6 × His-Tag on the N-terminal can be used in Western blot detection with 6 × His-tag antibodies. The 6 × His-tag can also be used in removal or purification of the BFP.
Usage : For Research Use Only! Not to be used in humans
Storage : At -20 centigrade.
At -80 centigrade for long-term storage.
Reconstitution : Reconstitute with dH2O to 1 mg/mL
Handling : Centrifuge the vial prior to opening.
Synonyms BFP, Blue Fluorescent Protein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BFP Products

Required fields are marked with *

My Review for All BFP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon