"MT2A" Related Products

Expand
Expand

Recombinant Human MT2A, GST-tagged

Cat.No.: MT2A-130H
Product Overview: Recombinant Human MT2A(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein-2 is a protein that in humans is encoded by the MT2A gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 32.4 kDa
AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MT2A metallothionein 2A [ Homo sapiens (human) ]
Official Symbol: MT2A
Synonyms: MT2A; MT2; metallothionein 2A; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
Gene ID: 4502
mRNA Refseq: NM_005953
Protein Refseq: NP_005944
MIM: 156360
UniProt ID: P02795
Chromosome Location: 16q13
Pathway: Cytokine Signaling in Immune system; Immune System; Interferon Signaling; Interferon gamma signaling; Mineral absorption
Function: drug binding; protein binding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.