Recombinant Human MYH9, GST-tagged MYH9-30H

Recombinant Human MYH9, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MYH9, GST-tagged

Recombinant Human MYH9, GST-tagged

MYH9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MYH9-30H
Product Overview : Recombinant Human MYH9, fused with N-terminal GST, was expressed in E. coli.
Description : This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.
Source : E. coli
Species : Human
Tag : GST
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAK IAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRAN ASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Shipping : Upon receipt, store it immediately at -20°C to -80°C.
Gene Name : MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ]
Official Symbol : MYH9
Synonyms : MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A
Gene ID : 4627
mRNA Refseq : NM_002473
Protein Refseq : NP_002464
MIM : 160775
UniProt ID : P35579
Chromosome Location : 22q13.1
Pathway : Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton
Function : ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy