"CDK8" Related Products

Expand
Expand

Recombinant Human CDK8, GST-tagged

Cat.No.: CDK8-11H
Product Overview: Recombinant Human CDK8(1 a.a. - 464 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 79.7 kDa
AA Sequence: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKH PNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHR DLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFA ELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQ QQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSAT SQQPPQYSHQTHRY
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CDK8 cyclin-dependent kinase 8 [ Homo sapiens (human) ]
Official Symbol: CDK8
Synonyms: cyclin-dependent kinase 8; K35; MGC126074; MGC126075; protein kinase K35; CDK8 protein kinase; cell division protein kinase 8; EC 2.7.11.22,EC 2.7.11.23; Protein kinase K35; CDK8; OTTHUMP00000018158; Mediator complex subunit CDK8; Mediator of RNA polymerase II transcription subunit CDK8
Gene ID: 1024
mRNA Refseq: NM_001260
Protein Refseq: NP_001251
MIM: 603184
UniProt ID: P49336
Chromosome Location: 13q12
Pathway: Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants; Developmental Biology; Fatty acid, triacylglycerol, and ketone body metabolism
Function: ATP binding; RNA polymerase II carboxy-terminal domain kinase activity; cyclin-dependent protein serine/threonine kinase activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.