"IFNA2" Related Products

Recombinant Human IFNA2 therapeutic protein

Cat.No.: IFNA2-P008H
Product Overview: Recombint Human Interferon, Alpha 2 therapeutic protein(human leukocyte clone hif-sn 206 protein moiety reduced). A type I interferon consisting of 165 amino acid residues with arginine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent.
Description: This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. The expression product is the active ingredient of PEG-Intron, Unitron PEG, Roferon-A and Intron-A.
Source: E. coli
Species: Human
Molecular Mass: 31 Kda
Protein length: 165aa
AA Sequence: CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKD SSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEV VRAEIMRSFSLSTNLQESLRSKE
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name: IFNA2 interferon, alpha 2 [ Homo sapiens ]
Official Symbol: IFNA2
Synonyms: IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765;
Gene ID: 3440
mRNA Refseq: NM_000605
Protein Refseq: NP_000596
MIM: 147562
UniProt ID: P01563
Chromosome Location: 9p22
Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem;
Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.