Recombinant Human IL1RN therapeutic protein(Anakinra)
Cat.No. : | IL1RN-P038H |
Product Overview : | The therapeutic protein is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between the protein and the native human IL-1Ra is that the protein has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 153 aa |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. The expression product is the active ingredient of Kineret. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCV KSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGV MVTKFYFQEDE |
Endotoxin : | < 0.1 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | IL1RN; DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; Anakinra |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens ] |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
Gene ID | 3557 |
mRNA Refseq | NM_000577 |
Protein Refseq | NP_000568 |
MIM | 147679 |
UniProt ID | P18510 |
Chromosome Location | 2q14.2 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; IL-1 Signaling Pathway, organism-specific biosystem; IL1-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem; Interleukin-1 signaling, organism-specific biosystem; Signaling by Interleukins, organism-specific biosystem; |
Function | interleukin-1 Type I receptor antagonist activity; interleukin-1 Type II receptor antagonist activity; interleukin-1 receptor antagonist activity; interleukin-1 receptor antagonist activity; interleukin-1 receptor binding; interleukin-1, Type I receptor binding; interleukin-1, Type II receptor binding; |
◆ Recombinant Proteins | ||
Il1rn-168M | Recombinant Active Mouse IL1RN Protein, His-tagged(C-ter) | +Inquiry |
IL1RN-89P | Recombinant Pig IL1RN protein | +Inquiry |
IL1RN-188H | Active Recombinant Human IL1RN protein(Arg26-Glu177) | +Inquiry |
IL1RN-314H | Recombinant Human IL1RN protein, hFc-tagged | +Inquiry |
IL1RN-164H | Active Recombinant Human IL1RN Protein (Arg26-Glu177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *