Recombinant Human FGF7 therapeutic protein(Palifermin)

Cat.No. : FGF7-P013H
Product Overview : Recombinant Human Fibroblast Growth Factor 7 therapeutic protein is a recombinant human keratinocyte growth factor (KGF). It is 140 residues long, and is produced using E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 139aa
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.The expression product is the active ingredient of Kepivance.
Molecular Mass : 16.2kDa
AA Sequence : SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEG KLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Purity : >95%
Alias : FGF7; KGF; FGF-7; HBGF-7; Palifermin
Gene Name FGF7 fibroblast growth factor 7 [ Homo sapiens ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781
Chromosome Location 15q21.2
Pathway Downstream signaling of activated FGFR, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; FGFR2b ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; Glypican 3 network, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem;
Function chemoattractant activity; growth factor activity; heparin binding; type 2 fibroblast growth factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0
cart-icon
0
compare icon