"PRKCZ" Related Products

Expand
Expand

Recombinant Human PRKCZ, His-tagged

Cat.No.: PRKCZ-4811H
Product Overview: Recombinant Human Protein Kinase C Zeta type/PRKCZ is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Val592) of Human PRKCZ fused with a polyhistidine tag at the C-terminus.
Description: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW VDSE GDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR RWRKLYRA NGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC RKHMDSVMPSQE PPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRV IGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE KHVFEQASSNPFLVGLHSCFQ TTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI CIALNFLHERGIIYRDLKLDNVL LDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP EILRGEEYGFSVDWWALGVLMFEMMAG RSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF LSVKASHVLKGFLNKDPKERLGCRPQTGFSD IKSHAFFRSIDWDLLEKKQALPPFQPQIT DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSE FEGFEYINPLLLSTEESV
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: PRKCZ protein kinase C, zeta [ Homo sapiens (human) ]
Official Symbol: PRKCZ
Synonyms: PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; nPKC-zeta; PKC-ZETA; NP_001028753.1; EC 2.7.11.13; NP_001028754.1; NP_001229803.1; NP_002735.3
Gene ID: 5590
mRNA Refseq: NM_001033581
Protein Refseq: NP_001028753
MIM: 176982
UniProt ID: Q05513
Chromosome Location: 1p36.33-p36.2
Pathway: AGE/RAGE pathway; CDC42 signaling events; CXCR4-mediated signaling events
Function: 14-3-3 protein binding; ATP binding; insulin receptor substrate binding; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.