Recombinant Mouse CD74, His-tagged CD74-9493M

Recombinant Mouse CD74, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse CD74, His-tagged

Recombinant Mouse CD74, His-tagged

CD74 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD74-9493M
Product Overview : A DNA sequence encoding the extracellular domain (56-215) of mouse CD74 isoform 2 was fused with a polyhistidine tag at the C-terminus.
Source : HEK293 cells
Species : Mouse
Tag : His
Form : 25 mM Tris-HCl, pH7.4, 100 mM NaCl, 1 mM DTT
Molecular Mass : The recombinant mouse CD74 consists of 160 amino acids and has a calculated molecular mass of 18.3KDa. It migrates as an approximately 25kDa band in SDS-PAGE under reducing conditions due to glycosylation.
AA Sequence : QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLT RSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGV TRQELGQVTL
Purity : >95% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃. Recommend to aliquot the proteinin to smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name : Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus ]
Official Symbol : CD74
Synonyms : CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA;
Gene ID : 16149
mRNA Refseq : NM_001042605
Protein Refseq : NP_001036070
Pathway : Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem;
Function : MHC class II protein binding; beta-amyloid binding; contributes_to cytokine binding; cytokine binding; cytokine receptor activity; cytokine receptor activity; nitric-oxide synthase binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy