"DRD5" Related Products

Expand
Expand

Recombinant Human DRD5

Cat.No.: DRD5-12H
Product Overview: Recombinant Human DRD5, fused without tag, was expressed in wheat germ.
Description: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Source: Wheat germ
Species: Human
Form: Liquid
Molecular Mass: 52.47 kDa
AA Sequence: MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANM TNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKR KMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTY AISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGC SHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPV AESVWELDCEGEISLDKITPFTPNGFH
Applications: Antibody Production; Functional Study; Compound Screening
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name: DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
Official Symbol: DRD5
Synonyms: DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
Gene ID: 1816
mRNA Refseq: NM_000798
Protein Refseq: NP_000789
MIM: 126453
UniProt ID: P21918
Chromosome Location: 4p16.1
Pathway: Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Function: G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.