Active Recombinant human CA5A Full Length protein, His-tagged

Cat.No. : CA5A-719H
Product Overview : Recombinant Human CA5A protein(Ala40-Ser305), fused with C-terminal His tag, was expressed in E. coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala40-Ser305
Tag : C-His
Form : Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
Bio-activity : Measured by its esterase activity. The specific activity is >500 pmoles/min/μg.
Molecular Mass : The protein has a calculated MW of 31 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.9 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSAHHHHHHHHHH
Gene Name CA5A carbonic anhydrase VA, mitochondrial [ Homo sapiens ]
Official Symbol CA5A
Synonyms CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial;
Gene ID 763
mRNA Refseq NM_001739
Protein Refseq NP_001730
MIM 114761
UniProt ID P35218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA5A Products

Required fields are marked with *

My Review for All CA5A Products

Required fields are marked with *

0
cart-icon
0
compare icon