Active Recombinant human CA5A Full Length protein, His-tagged

• Cat.No.: CA5A-719H
• Product Overview: Recombinant Human CA5A protein(Ala40-Ser305), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ala40-Ser305
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
• Bio-activity: Measured by its esterase activity. The specific activity is >500 pmoles/min/μg.
• Molecular Mass: The protein has a calculated MW of 31 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.9 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSAHHHHHHHHHH

Gene Information

• Gene Name: CA5A carbonic anhydrase VA, mitochondrial [ Homo sapiens ]
• Official Symbol: CA5A
• Synonyms: CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial
• Gene ID: 763
• mRNA Refseq: NM_001739
• Protein Refseq: NP_001730
• MIM: 114761
• UniProt ID: P35218