Active Recombinant Human TP53, His-tagged

Cat.No. : TP53-3436H
Product Overview : Recombinant human p53 produced in human HEK293 cells is a single, glycosylated, polypeptide chain with a 6His tag at the N-terminus. It contains 412 (19+393) amino acids, and having a predicted molecular mass of approximately 45.8kD, but migrates in SDS-PAGE with an apparent molecular mass of 55kD.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Tumor proteins p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), are encoded by homologous genes in various organisms such as TP53 (humans) and Trp53 (mice). This homolog is crucial in multicellular organisms, where it prevents cancer formation, thus, functions as a tumor suppressor. As such, p53 has been described as "the guardian of the genome" because of its role in conserving stability by preventing genome mutation. Hence TP53 is classified as a tumor suppressor gene.
Form : 10mM HEPES-Na (pH7.9), 150mM NaCl and 3mM EDTA
Bio-activity : Tumor suppressor protein p53 is involved in transcription activation, DNA repair, cell cycle arrest and apoptosis. Recombinant human p53 protein is ideal for the studies of transcriptional activation, protein-protein interactions and other related function assays.
AA Sequence : MHHHHHHGRRASVEDVVCCSEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFT EDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPA LNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLR VEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCA CPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALE LKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
Purity : ≥90%, as determined by SDS-PAGE
Usage : FOR RESEARCH ONLY
Storage : The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name TP53 tumor protein p53 [ Homo sapiens ]
Official Symbol TP53
Synonyms P53; BCC7; LFS1; TRP53; cellular tumor antigen p53; antigen NY-CO-13; mutant tumor protein 53; p53 tumor suppressor; phosphoprotein p53; transformation-related protein 53; tumor protein 53
Gene ID 7157
mRNA Refseq NM_000546
Protein Refseq NP_000537
MIM 191170
UniProt ID P04637
Chromosome Location 17p13.1
Pathway AMPK signaling, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
Function ATP binding; DNA binding; MDM2/MDM4 family protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TP53 Products

Required fields are marked with *

My Review for All TP53 Products

Required fields are marked with *

0
cart-icon
0
compare icon