Recombinant Human MYC, His-tagged MYC-2522H

Recombinant Human MYC, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MYC, His-tagged

Recombinant Human MYC, His-tagged

MYC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MYC-2522H
Product Overview : Recombinant human myc proto-oncogene protein produced in E.coli is a single non-glycosylated polypeptide with a 8His tag at the C-terminus. It contains 452 (442+10) amino acids having a predicted molecular mass of approximately 50.4kD, but migrates in SDS-PAGE with an apparent molecular mass of 60kD.
Description : Myc (c-Myc) is a regulator gene that codes for a transcription factor. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation.
Source : E. coli
Species : Human
Tag : His
Form : 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity : c-Myc protein is a multi-functional protein involved in cell cycle progression, apoptosis, cellular transformation and transcriptional regulation. Recombinant c-Myc protein is ideal for the studies of protein-protein interactions and other related function assays.
AA Sequence : MASMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCS PSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSP SSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPH SPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQ RRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA LEHHHHHHHH
Purity : ≥90%, as determined by SDS-PAGE
Usage : FOR RESEARCH ONLY
Storage : The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name : MYC v-myc avian myelocytomatosis viral oncogene homolog [ Homo sapiens ]
Official Symbol : MYC
Synonyms : MRTL; MYCC; c-Myc; bHLHe39; myc proto-oncogene protein; avian myelocytomatosis viral oncogene homolog; class E basic helix-loop-helix protein 39; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; v-myc myelocytomatosis viral oncogene homolog
Gene ID : 4609
mRNA Refseq : NM_002467
Protein Refseq : NP_002458
MIM : 190080
UniProt ID : P01106
Chromosome Location : 8q24.21
Pathway : Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem
Function : DNA binding; E-box binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy