"MYC" Related Products

Expand
Expand
Expand

Recombinant Human MYC, His-tagged

Cat.No.: MYC-2522H
Product Overview: Recombinant human myc proto-oncogene protein produced in E.coli is a single non-glycosylated polypeptide with a 8His tag at the C-terminus. It contains 452 (442+10) amino acids having a predicted molecular mass of approximately 50.4kD, but migrates in SDS-PAGE with an apparent molecular mass of 60kD.
Description: Myc (c-Myc) is a regulator gene that codes for a transcription factor. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation.
Source: E. coli
Species: Human
Tag: His
Form: 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity: c-Myc protein is a multi-functional protein involved in cell cycle progression, apoptosis, cellular transformation and transcriptional regulation. Recombinant c-Myc protein is ideal for the studies of protein-protein interactions and other related function assays.
AA Sequence: MASMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCS PSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSP SSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPH SPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQ RRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA LEHHHHHHHH
Purity: ≥90%, as determined by SDS-PAGE
Usage: FOR RESEARCH ONLY
Storage: The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name: MYC v-myc avian myelocytomatosis viral oncogene homolog [ Homo sapiens ]
Official Symbol: MYC
Synonyms: MRTL; MYCC; c-Myc; bHLHe39; myc proto-oncogene protein; avian myelocytomatosis viral oncogene homolog; class E basic helix-loop-helix protein 39; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; v-myc myelocytomatosis viral oncogene homolog
Gene ID: 4609
mRNA Refseq: NM_002467
Protein Refseq: NP_002458
MIM: 190080
UniProt ID: P01106
Chromosome Location: 8q24.21
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem
Function: DNA binding; E-box binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.