Recombinant Human CBLB, GST-tagged

• Cat.No.: CBLB-579H
• Product Overview: Recombinant Human CBLB(21 a.a. - 129 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 21-129 a.a.
• Description: CBL-B is an E3 ubiquitin-protein ligase that in humans is encoded by the CBLB gene.[1][2] CBLB is a member of the CBL gene family.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.73 kDa
• AA Sequence: RILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDN QKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CBLB Cbl proto-oncogene B, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: CBLB
• Synonyms: Cbl-b; RNF56; Nbla00127; E3 ubiquitin-protein ligase CBL-B; Cas-Br-M (murine) ecotropic retroviral transforming sequence b; Cas-Br-M (murine) ectropic retroviral transforming sequence b; Cbl proto-oncogene, E3 ubiquitin protein ligase B; RING finger protein 56; SH3-binding protein CBL-B; casitas B-lineage lymphoma proto-oncogene b; signal transduction protein CBL-B
• Gene ID: 868
• mRNA Refseq: NM_170662
• Protein Refseq: NP_733762
• MIM: 604491
• UniProt ID: Q13191
• Chromosome Location: 3q13.11
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen activates B Cell Receptor (BCR) leading to generation of second messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: calcium ion binding; ligase activity; phosphotyrosine binding