Recombinant Human CBLB, GST-tagged

Cat.No. : CBLB-579H
Product Overview : Recombinant Human CBLB(21 a.a. - 129 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 21-129 a.a.
Description : CBL-B is an E3 ubiquitin-protein ligase that in humans is encoded by the CBLB gene.[1][2] CBLB is a member of the CBL gene family.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : RILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDN QKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name CBLB Cbl proto-oncogene B, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol CBLB
Synonyms Cbl-b; RNF56; Nbla00127; E3 ubiquitin-protein ligase CBL-B; Cas-Br-M (murine) ecotropic retroviral transforming sequence b; Cas-Br-M (murine) ectropic retroviral transforming sequence b; Cbl proto-oncogene, E3 ubiquitin protein ligase B; RING finger protein 56; SH3-binding protein CBL-B; casitas B-lineage lymphoma proto-oncogene b; signal transduction protein CBL-B
Gene ID 868
mRNA Refseq NM_170662
Protein Refseq NP_733762
MIM 604491
UniProt ID Q13191
Chromosome Location 3q13.11
Pathway Adaptive Immune System, organism-specific biosystem; Antigen activates B Cell Receptor (BCR) leading to generation of second messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem
Function calcium ion binding; ligase activity; phosphotyrosine binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBLB Products

Required fields are marked with *

My Review for All CBLB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon