Recombinant Human BRD7, GST-tagged
Cat.No. : | BRD7-13H |
Product Overview : | Recombinant Human BRD7 full-length ORF (1 a.a. - 651 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 97.13 kDa |
AA Sequence : | MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPG EEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRK DPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLL HSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTT GRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLA TCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVT NFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | BRD7 bromodomain containing 7 [ Homo sapiens ] |
Official Symbol | BRD7 |
Synonyms | BP75; NAG4; CELTIX1; bromodomain-containing protein 7; 75 kDa bromodomain protein; protein CELTIX-1 |
Gene ID | 29117 |
mRNA Refseq | NM_001173984 |
Protein Refseq | NP_001167455 |
UniProt ID | Q9NPI1 |
Chromosome Location | 16q12 |
Pathway | Wnt Signaling Pathway NetPath, organism-specific biosystem |
Function | histone binding; lysine-acetylated histone binding; p53 binding |
◆ Recombinant Proteins | ||
BRD7-1086M | Recombinant Mouse BRD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRD7-13H | Recombinant Human BRD7, GST-tagged | +Inquiry |
BRD7-576HF | Recombinant Full Length Human BRD7 Protein, GST-tagged | +Inquiry |
BRD7-12545Z | Recombinant Zebrafish BRD7 | +Inquiry |
Brd7-1890M | Recombinant Mouse Brd7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD7-8411HCL | Recombinant Human BRD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRD7 Products
Required fields are marked with *
My Review for All BRD7 Products
Required fields are marked with *
0
Inquiry Basket