Recombinant Human ACVR1C, Fc-tagged ACVR1C-531H

Recombinant Human ACVR1C, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ACVR1C, Fc-tagged

Recombinant Human ACVR1C, Fc-tagged

ACVR1C Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ACVR1C-531H
Product Overview : The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 - Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNI TLHLPTASPNAPKLGPMESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition.
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : ACVR1C activin A receptor, type IC [ Homo sapiens ]
Official Symbol : ACVR1C
Synonyms : ACVR1C; activin A receptor, type IC; activin receptor type-1C; ACVRLK7; ALK7; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7;
Gene ID : 130399
mRNA Refseq : NM_001111031
Protein Refseq : NP_001104501
MIM : 608981
UniProt ID : Q8NER5
Chromosome Location : 2q24.2
Pathway : Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : ATP binding; activin receptor activity, type I; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta-activated receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy