Recombinant Human ACVR2B, Fc-tagged, Biotinylated ACVR2B-533H

Recombinant Human ACVR2B, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ACVR2B, Fc-tagged, Biotinylated

Recombinant Human ACVR2B, Fc-tagged, Biotinylated

ACVR2B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ACVR2B-533H
Product Overview : The recombinant human ACVR2B-Fc fusion protein is expressed as a 344 amino acid protein consisting of Ser19 - Thr134 region of ACVR2B (UniProt accession #Q13705) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized ACVR2B binds Activin or Inhibin in a functional ELISA. Neutralize Activin-induced inhibition of MPC11 cell proliferation and hemoglobin expression in K562 human chronic myelogenous leukemia cells.
Molecular Mass : Calculated molecular mass (kDa): 38.9; Estimated by SDS-PAGE under reducing condition (kDa): ~55
AA Sequence : SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVA TEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : ACVR2B activin A receptor, type IIB [ Homo sapiens ]
Official Symbol : ACVR2B
Synonyms : ACVR2B; activin A receptor, type IIB; activin receptor type-2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB;
Gene ID : 93
mRNA Refseq : NM_001106
Protein Refseq : NP_001097
MIM : 602730
UniProt ID : Q13705
Chromosome Location : 3p22
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem;
Function : ATP binding; activin binding; activin receptor activity, type II; contributes_to activin receptor activity, type II; growth factor binding; inhibin beta-A binding; inhibin beta-B binding; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; protein serine/threonine kinase activity; protein serine/threonine/tyrosine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy