Recombinant Human ACVR2B protein, His-tagged
| Cat.No. : | ACVR2B-4633H |
| Product Overview : | Recombinant Human ACVR2B protein(23-175 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-175 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | EAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHED |
| Gene Name | ACVR2B activin A receptor, type IIB [ Homo sapiens ] |
| Official Symbol | ACVR2B |
| Synonyms | ACVR2B; activin A receptor, type IIB; activin receptor type-2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB; |
| Gene ID | 93 |
| mRNA Refseq | NM_001106 |
| Protein Refseq | NP_001097 |
| MIM | 602730 |
| UniProt ID | Q13705 |
| ◆ Recombinant Proteins | ||
| ACVR2B-151R | Recombinant Rat ACVR2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACVR2B-257H | Active Recombinant Human ACVR2B Protein, GST-tagged | +Inquiry |
| ACVR2B-1503HFL | Recombinant Full Length Human ACVR2B Protein, C-Flag-tagged | +Inquiry |
| ACVR2B-258H | Recombinant Human ACVR2B Protein, GST-tagged | +Inquiry |
| ACVR2B-533H | Active Recombinant Human ACVR2B, Fc-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
| ACVR2B-2724HCL | Recombinant Human ACVR2B cell lysate | +Inquiry |
| ACVR2B-2540MCL | Recombinant Mouse ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR2B Products
Required fields are marked with *
My Review for All ACVR2B Products
Required fields are marked with *



