Active Recombinant Human AXL, Fc-tagged
Cat.No. : | AXL-538H |
Product Overview : | The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 26-447 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
Bio-activity : | Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
AA Sequence : | APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLW LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTP GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWT HWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ GDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | AXL AXL receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | AXL |
Synonyms | AXL; AXL receptor tyrosine kinase; tyrosine-protein kinase receptor UFO; JTK11; UFO; AXL oncogene; oncogene AXL; AXL transforming sequence/gene; |
Gene ID | 558 |
mRNA Refseq | NM_001699 |
Protein Refseq | NP_001690 |
MIM | 109135 |
UniProt ID | P30530 |
Chromosome Location | 19q13.1 |
Function | ATP binding; nucleotide binding; protein heterodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
◆ Recombinant Proteins | ||
Axl-813H | Recombinant Human Axl Protein | +Inquiry |
Axl-2622H | Active Recombinant Human Axl protein, His-tagged | +Inquiry |
Axl-132M | Recombinant Mouse Axl protein, His&hFc-tagged | +Inquiry |
AXL-920H | Recombinant Human AXL Protein, DDK/His-tagged | +Inquiry |
AXL-779H | Recombinant Human AXL protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AXL-2281HCL | Recombinant Human AXL cell lysate | +Inquiry |
AXL-2476MCL | Recombinant Mouse AXL cell lysate | +Inquiry |
Efficacy of newly discovered DNA aptamers targeting AXL in a lung cancer cell with acquired resistance to Erlotinib
Journal: Translational Cancer Research PubMed ID: 35116429 Data: 2021/2/1
Authors: Ji An Hwang, Jae Young Hur, Chang-Min Choi
Article Snippet:The resulting aptamers were used in the next SELEX rounds.The resulting aptamers were used in the next SELEX rounds.. The target protein used for aptamers selection were recombinant Human AXL extracellular domain (Met 1-Pro 449), fused with a polyhistidine tag at the C-terminus produced in Human Cell (Creative BioMart, Shirley, NY, USA).

Effects

Efficacy

Binding affinity of
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AXL Products
Required fields are marked with *
My Review for All AXL Products
Required fields are marked with *