Recombinant Human AXL, Fc-tagged AXL-538H

Recombinant Human AXL, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human AXL, Fc-tagged

Recombinant Human AXL, Fc-tagged

AXL Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : AXL-538H
Product Overview : The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence : APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLW LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTP GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWT HWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ GDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : AXL AXL receptor tyrosine kinase [ Homo sapiens ]
Official Symbol : AXL
Synonyms : AXL; AXL receptor tyrosine kinase; tyrosine-protein kinase receptor UFO; JTK11; UFO; AXL oncogene; oncogene AXL; AXL transforming sequence/gene;
Gene ID : 558
mRNA Refseq : NM_001699
Protein Refseq : NP_001690
MIM : 109135
UniProt ID : P30530
Chromosome Location : 19q13.1
Function : ATP binding; nucleotide binding; protein heterodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy