Recombinant Human ICOSLG, Fc-tagged, Biotinylated ICOSLG-541H

Recombinant Human ICOSLG, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ICOSLG, Fc-tagged, Biotinylated

Recombinant Human ICOSLG, Fc-tagged, Biotinylated

ICOSLG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ICOSLG-541H
Product Overview : The recombinant human B7-H2/ICOSL/CD275-Fc fusion protein is expressed as a 466 amino acid protein consisting of Asp19 - Thr256 region of B7-H2 (UniProt accession #O75144) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human ICOS and stimulates human T cell proliferation in the presence of anti-CD3.
Molecular Mass : Calculated molecular mass 52 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation.
AA Sequence : DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLR GDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRP NVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDK ITENPVSTGEKNAATSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens ]
Official Symbol : ICOSLG
Synonyms : ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L;
Gene ID : 23308
mRNA Refseq : NM_015259
Protein Refseq : NP_056074
MIM : 605717
UniProt ID : O75144
Chromosome Location : 21q22.3
Pathway : Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; Intestinal immune network for IgA production, organism-specific biosystem; Intestinal immune network for IgA production, conserved biosystem;
Function : receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy