Active Recombinant Human CD22, His-tagged, Biotinylated
| Cat.No. : | CD22-559H | 
| Product Overview : | The recombinant human CD22 ECD is expressed as a 675 amino acid protein consisting of Asp20 - Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal His-tag. It contains 12 potential sites for N-linked glycosylation. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Human Cells | 
| Tag : | His | 
| Protein Length : | 20-683 a.a. | 
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). | 
| Bio-activity : | Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity (KD< 5="" nm)="" by=""> | 
| Molecular Mass : | Calculated molecular mass (kDa): 76.0; Estimated by SDS-PAGE under reducing condition (kDa): 100-110 probably due to glycosylation. | 
| AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG HHHHHHHH | 
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the | 
| Purity : | >90% judged by SDS-PAGE under reducing condition. | 
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. | 
| Conjugation : | Biotin | 
| Gene Name | CD22 CD22 molecule [ Homo sapiens ] | 
| Official Symbol | CD22 | 
| Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; | 
| Gene ID | 933 | 
| mRNA Refseq | NM_001185099 | 
| Protein Refseq | NP_001172028 | 
| MIM | 107266 | 
| UniProt ID | P20273 | 
| Chromosome Location | 19q13.1 | 
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; | 
| Function | protein binding; sugar binding; | 
| ◆ Recombinant Proteins | ||
| CD22-482HAF555 | Active Recombinant Human CD22 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry | 
| CD22-051H | Recombinant Human CD22 protein, His-Avi-tagged, Biotinylated | +Inquiry | 
| Cd22-1153RP | Recombinant Rat Cd22 protein, Fc-tagged, R-PE labeled | +Inquiry | 
| CD22-4343H | Recombinant Human CD22 protein, His-Avi-tagged, Biotinylated | +Inquiry | 
| CD22-561HAF555 | Active Recombinant Human CD22 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry | 
| CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
  
        
    
      
            