Active Recombinant Human CD22, Fc-tagged, Biotinylated
| Cat.No. : | CD22-560H |
| Product Overview : | The recombinant human CD22-Fc fusion protein is expressed as an 892 amino acid protein consisting of Asp20 - Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 20-683 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity. |
| Molecular Mass : | Calculated molecular mass (kDa): 100.2; Estimated by SDS-PAGE under reducing condition (kDa): 120-130 probably due to glycosylation |
| AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
| Official Symbol | CD22 |
| Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
| Gene ID | 933 |
| mRNA Refseq | NM_001185099 |
| Protein Refseq | NP_001172028 |
| MIM | 107266 |
| UniProt ID | P20273 |
| Chromosome Location | 19q13.1 |
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; |
| Function | protein binding; sugar binding; |
| ◆ Recombinant Proteins | ||
| Cd22-1153RAF647 | Recombinant Rat Cd22 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD22-441H | Recombinant Human CD22 Protein, His-tagged | +Inquiry |
| CD22-24H | Active Recombinant Human CD22 Protein, Fc-tagged, Atto 647N conjugated | +Inquiry |
| CD22-442H | Recombinant Human CD22 Protein, His-tagged | +Inquiry |
| CD22-273H | Recombinant Human CD22 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
| CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
