Active Recombinant Human CD22, Fc-tagged
Cat.No. : | CD22-561H |
Product Overview : | The recombinant human CD22-Fc fusion protein is expressed as an 892 amino acid protein consisting of Asp20 - Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 20-683 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity. |
Molecular Mass : | Calculated molecular mass (kDa): 100.2; Estimated by SDS-PAGE under reducing condition (kDa): 120-130 probably due to glycosylation |
AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
Official Symbol | CD22 |
Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
Gene ID | 933 |
mRNA Refseq | NM_001185099 |
Protein Refseq | NP_001172028 |
MIM | 107266 |
UniProt ID | P20273 |
Chromosome Location | 19q13.1 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; |
Function | protein binding; sugar binding; |
◆ Recombinant Proteins | ||
CD22-496H | Recombinant Human CD22 Protein (Asp20-Arg687), C-hFc and 6×His-tagged | +Inquiry |
CD22-442H | Recombinant Human CD22 Protein, His-tagged | +Inquiry |
CD22-3947HA | Recombinant Human CD22 protein, His-tagged, APC labeled | +Inquiry |
CD22-561HA | Recombinant Human CD22 protein, Fc-tagged, APC labeled | +Inquiry |
CD22-561HP | Recombinant Human CD22 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
Development and characterization of a camelid single-domain antibody directed to human CD22 biomarker.
Journal: Biotechnology and applied biochemistry PubMed ID: 29543347 Data: 2018/11/13
Authors: Fatemeh Faraji, Nader Tajik, Mahdi Habibi-Anbouhi
Article Snippet:Both the first and booster immunizations were done in absence of adjuvant.Both the first and booster immunizations were done in absence of adjuvant.. Prior to each immunization, a blood specimen was collected from the jugular vein and separated sera were used to evaluate the immunization process by ELISA on a plate (Nunc-MaxiSorp) coated by recombinant human CD22 antigen (Creative BioMart, USA). . Polyclonal rabbit anti-camel IgGs (Pasteur Institute of Iran, Iran) and anti-Rabbit-IgG Horse Radish Peroxidase (HRP)-conjugated monoclonal antibody (Sigma, Germany) were used to detect the bound camel antibodies.Polyclonal rabbit anti-camel IgGs (Pasteur Institute of Iran, Iran) and anti-Rabbit-IgG Horse Radish Peroxidase (HRP)-conjugated monoclonal antibody (Sigma, Germany) were used to detect the bound camel antibodies.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *