Recombinant Human BTLA, Fc-tagged, Biotinylated BTLA-565H

Recombinant Human BTLA, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BTLA, Fc-tagged, Biotinylated

Recombinant Human BTLA, Fc-tagged, Biotinylated

BTLA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BTLA-565H
Product Overview : The recombinant human CD272-Fc fusion protein is expressed as a 350 amino acid protein consisting of Lys31 - Pro152 region of CD272 (UniProt accession #Q7Z6A9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human HVEM/TNFRSF14 and blocks HVEM-CD272 mediated signaling activity.
Molecular Mass : Calculated molecular mass 39.6 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation.
AA Sequence : KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEP VLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : BTLA B and T lymphocyte associated [ Homo sapiens ]
Official Symbol : BTLA
Synonyms : BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743;
Gene ID : 151888
mRNA Refseq : NM_001085357
Protein Refseq : NP_001078826
MIM : 607925
UniProt ID : Q7Z6A9
Chromosome Location : 3q13.2
Pathway : Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy