Active Recombinant Human BTLA, Fc-tagged, Biotinylated
| Cat.No. : | BTLA-565H |
| Product Overview : | The recombinant human CD272-Fc fusion protein is expressed as a 350 amino acid protein consisting of Lys31 - Pro152 region of CD272 (UniProt accession #Q7Z6A9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 31-152 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds human HVEM/TNFRSF14 and blocks HVEM-CD272 mediated signaling activity. |
| Molecular Mass : | Calculated molecular mass 39.6 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation. |
| AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEP VLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
| Official Symbol | BTLA |
| Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
| Gene ID | 151888 |
| mRNA Refseq | NM_001085357 |
| Protein Refseq | NP_001078826 |
| MIM | 607925 |
| UniProt ID | Q7Z6A9 |
| Chromosome Location | 3q13.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| BTLA-189H | Active Recombinant Human BTLA, HIgG1 Fc-tagged | +Inquiry |
| BTLA-8698MAF555 | Recombinant Mouse Btla Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| BTLA-1589H | Recombinant Human BTLA protein, His-tagged | +Inquiry |
| BTLA-567H | Active Recombinant Human BTLA Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| BTLA-610H | Recombinant Human BTLA Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
| BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *




