Recombinant Human CD38, Fc-tagged CD38-574H

Recombinant Human CD38, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD38, Fc-tagged

Recombinant Human CD38, Fc-tagged

CD38 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD38-574H
Product Overview : The recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 - Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose.
Molecular Mass : Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
AA Sequence : RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSR RFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISK RNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD38 CD38 molecule [ Homo sapiens ]
Official Symbol : CD38
Synonyms : CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; cADPr hydrolase 1; cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase; T10;
Gene ID : 952
mRNA Refseq : NM_001775
Protein Refseq : NP_001766
MIM : 107270
UniProt ID : P28907
Chromosome Location : 4p15.32
Pathway : Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem;
Function : NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy