Active Recombinant Human CTLA4, Fc-tagged, Biotinylated

Cat.No. : CTLA4-593H
Product Overview : The recombinant human CTLA4 ECD is expressed as a 138-amino acid protein consisting of Lys36 - Asp161 region of CTLA4 (UniProt accession #Q16410) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. It contains 2 potential N-linked glycosylation sites.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 36-161 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to human B7 family ligands, CD80/B7-1 and CD86/B7-2, and anti-CTLA4 monoclonal antibody. Inhibit IL-2 secretion in stimulated human Jurkat T cell cells.
Molecular Mass : Calculated molecular mass 39.1 kDa; estimated by SDS-PAGE under reducing condition ~50 kDa probably due to glycosylation
AA Sequence : KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSG NQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ]
Official Symbol CTLA4
Synonyms CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3;
Gene ID 1493
mRNA Refseq NM_001037631
Protein Refseq NP_001032720
UniProt ID P16410
Chromosome Location 2q33
Pathway Adaptive Immune System, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTLA4 Products

Required fields are marked with *

My Review for All CTLA4 Products

Required fields are marked with *

0
cart-icon