"MUC4" Related Products

Recombinant Human MUC4 protein, GST-tagged

Cat.No.: MUC4-112H
Product Overview: Recombinant Human MUC4 (79 a.a. - 188 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGR DPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MUC4 mucin 4, cell surface associated [ Homo sapiens ]
Official Symbol: MUC4
Synonyms: ASGP; MUC-4; HSA276359; mucin-4; ascites sialoglycoprotein; mucin 4, tracheobronchial; pancreatic adenocarcinoma mucin; testis mucin; tracheobronchial mucin
Gene ID: 4585
mRNA Refseq: NM_004532
Protein Refseq: NP_004523
MIM: 158372
UniProt ID: Q99102
Chromosome Location: 3q29
Pathway: Metabolism of proteins, organism-specific biosystem; O-linked glycosylation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem
Function: ErbB-2 class receptor binding; extracellular matrix constituent, lubricant activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.