Recombinant Human MUC4 protein, GST-tagged
Cat.No. : | MUC4-112H |
Product Overview : | Recombinant Human MUC4 (79 a.a. - 188 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 79-188 a.a. |
Description : | The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGR DPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MUC4 mucin 4, cell surface associated [ Homo sapiens ] |
Official Symbol | MUC4 |
Synonyms | ASGP; MUC-4; HSA276359; mucin-4; ascites sialoglycoprotein; mucin 4, tracheobronchial; pancreatic adenocarcinoma mucin; testis mucin; tracheobronchial mucin |
Gene ID | 4585 |
mRNA Refseq | NM_004532 |
Protein Refseq | NP_004523 |
MIM | 158372 |
UniProt ID | Q99102 |
Chromosome Location | 3q29 |
Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem |
Function | ErbB-2 class receptor binding; extracellular matrix constituent, lubricant activity |
◆ Recombinant Proteins | ||
MUC4-4627H | Recombinant Human MUC4 Protein (Glu1875-Phe1914), N-GST tagged | +Inquiry |
MUC4-5750H | Recombinant Human MUC4 Protein, GST-tagged | +Inquiry |
MUC4-0215H | Recombinant Human MUC4 Protein (Gly1869-Asn1925), C-His-tagged | +Inquiry |
MUC4-112H | Recombinant Human MUC4 protein, GST-tagged | +Inquiry |
Muc4-5732M | Recombinant Mouse Muc4 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC4 Products
Required fields are marked with *
My Review for All MUC4 Products
Required fields are marked with *
0
Inquiry Basket