Recombinant Human MUC4 Protein, GST-tagged

Cat.No. : MUC4-5750H
Product Overview : Human MUC4 partial ORF ( NP_004523, 79 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUC4 mucin 4, cell surface associated [ Homo sapiens ]
Official Symbol MUC4
Synonyms MUC4; mucin 4, cell surface associated; mucin 4, tracheobronchial; mucin-4; testis mucin; tracheobronchial mucin; ascites sialoglycoprotein; pancreatic adenocarcinoma mucin; ASGP; MUC-4; HSA276359;
Gene ID 4585
mRNA Refseq NM_004532
Protein Refseq NP_004523
MIM 158372
UniProt ID Q99102

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC4 Products

Required fields are marked with *

My Review for All MUC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon