Recombinant Human DKC1 protein, GST-tagged DKC1-261H

Recombinant Human DKC1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DKC1 protein, GST-tagged

Recombinant Human DKC1 protein, GST-tagged

DKC1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DKC1-261H
Product Overview : Recombinant Human DKC1(1 a.a. - 514 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 84.1 kDa
Protein length : 1 a.a. - 514 a.a.
AA Sequence : MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACG SNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAG KEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTY IRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDT YPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRE SESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : DKC1 dyskeratosis congenita 1, dyskerin [ Homo sapiens ]
Official Symbol : DKC1
Synonyms : DKC1; dyskeratosis congenita 1, dyskerin; DKC; H/ACA ribonucleoprotein complex subunit 4; dyskerin; NAP57; NOLA4; XAP101; CBF5 homolog; cbf5p homolog; snoRNP protein DKC1; nucleolar protein NAP57; nucleolar protein family A member 4; nopp140-associated protein of 57 kDa; CBF5; DKCX; FLJ97620;
Gene ID : 1736
mRNA Refseq : NM_001363
Protein Refseq : NP_001354
MIM : 300126
UniProt ID : O60832
Chromosome Location : Xq28
Pathway : Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Extension of Telomeres, organism-specific biosystem; H/ACA ribonucleoprotein complex, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function : RNA binding; isomerase activity; protein binding; pseudouridine synthase activity; telomerase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy