Recombinant Human DKC1 protein, GST-tagged

Cat.No. : DKC1-261H
Product Overview : Recombinant Human DKC1(1 a.a. - 514 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 514 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 84.1 kDa
AA Sequence : MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACG SNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAG KEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTY IRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDT YPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRE SESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DKC1 dyskeratosis congenita 1, dyskerin [ Homo sapiens ]
Official Symbol DKC1
Synonyms DKC1; dyskeratosis congenita 1, dyskerin; DKC; H/ACA ribonucleoprotein complex subunit 4; dyskerin; NAP57; NOLA4; XAP101; CBF5 homolog; cbf5p homolog; snoRNP protein DKC1; nucleolar protein NAP57; nucleolar protein family A member 4; nopp140-associated protein of 57 kDa; CBF5; DKCX; FLJ97620;
Gene ID 1736
mRNA Refseq NM_001363
Protein Refseq NP_001354
MIM 300126
UniProt ID O60832
Chromosome Location Xq28
Pathway Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Extension of Telomeres, organism-specific biosystem; H/ACA ribonucleoprotein complex, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function RNA binding; isomerase activity; protein binding; pseudouridine synthase activity; telomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DKC1 Products

Required fields are marked with *

My Review for All DKC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon