Active Recombinant Human OSM, Fc-tagged
Cat.No. : | OSM-658H |
Product Overview : | The recombinant human OSM-Fc is expressed as a 433-amino acid active form consisting of Ala26 - Arg220 region of (UniProt accession #P13725) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 26-220 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.2 - 0.5 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency. |
Molecular Mass : | Calculated molecular mass (kDa): 48.7; Estimated by SDS-PAGE under reducing condition (kDa): ~55 |
AA Sequence : | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN ATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQ PPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | OSM oncostatin M [ Homo sapiens ] |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
Gene ID | 5008 |
mRNA Refseq | NM_020530 |
Protein Refseq | NP_065391 |
MIM | 165095 |
UniProt ID | P13725 |
Chromosome Location | 22q12.2 |
Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; growth factor activity; oncostatin-M receptor binding; |
◆ Recombinant Proteins | ||
OSM-259H | Recombinant Human OSM, StrepII-tagged | +Inquiry |
OSM-658H | Active Recombinant Human OSM, Fc-tagged | +Inquiry |
Osm-760M | Recombinant Mouse Osm protein, His-tagged | +Inquiry |
OSM-5550R | Recombinant Rhesus macaque OSM protein | +Inquiry |
OSM-4773H | Recombinant Human OSM Protein (Ala26-Arg221), His tagged | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *