Recombinant Human TGFBR1, Fc-tagged, Biotinylated TGFBR1-695H

Recombinant Human TGFBR1, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TGFBR1, Fc-tagged, Biotinylated

Recombinant Human TGFBR1, Fc-tagged, Biotinylated

TGFBR1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TGFBR1-695H
Product Overview : The recombinant human TGFBR1-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu34 - Glu125 region of TGFBR1 (UniProt accession #P36897) and a C-terminal Fc fusion from human IgG1, which exists as a dimer/tetramer/octamer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized TGFBR1 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 35.6; Estimated by SDS-PAGE under reducing condition (kDa): ~45
AA Sequence : LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCN KIELPTTVKSSPGLGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ]
Official Symbol : TGFBR1
Synonyms : TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1;
Gene ID : 7046
mRNA Refseq : NM_001130916
Protein Refseq : NP_001124388
MIM : 190181
UniProt ID : P36897
Chromosome Location : 9q22
Pathway : ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function : ATP binding; I-SMAD binding; SMAD binding; SMAD binding; contributes_to growth factor binding; metal ion binding; nucleotide binding; protein binding; protein heterodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta binding; contributes_to transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; contributes_to transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; ubiquitin protein ligase binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy