"TGFBR1" Related Products

Expand

Recombinant Human TGFBR1, Fc-tagged

Cat.No.: TGFBR1-696H
Product Overview: The recombinant human TGFBR1-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu34 - Glu125 region of TGFBR1 (UniProt accession #P36897) and a C-terminal Fc fusion from human IgG1, which exists as a dimer/tetramer/octamer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Immobilized TGFBR1 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.
Molecular Mass: Calculated molecular mass (kDa): 35.6; Estimated by SDS-PAGE under reducing condition (kDa): ~45
AA Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCN KIELPTTVKSSPGLGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ]
Official Symbol: TGFBR1
Synonyms: TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1;
Gene ID: 7046
mRNA Refseq: NM_001130916
Protein Refseq: NP_001124388
MIM: 190181
UniProt ID: P36897
Chromosome Location: 9q22
Pathway: ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function: ATP binding; I-SMAD binding; SMAD binding; SMAD binding; contributes_to growth factor binding; metal ion binding; nucleotide binding; protein binding; protein heterodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta binding; contributes_to transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; contributes_to transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; ubiquitin protein ligase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.