"CDT1" Related Products

Expand
Expand

Recombinant Human CDT1 protein, GST-tagged

Cat.No.: CDT1-105H
Product Overview: Recombinant Human CDT1(1 a.a. - 546 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 86.46 kDa
Protein length: 1 a.a. - 546 a.a.
AA Sequence: MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVD EVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGES CTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQD MMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRM EKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQR LERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDK AADLAHITARLAHQTRAEEGL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ]
Official Symbol: CDT1
Synonyms: CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2; Double parked, Drosophila, homolog of;
Gene ID: 81620
mRNA Refseq: NM_030928
Protein Refseq: NP_112190
MIM: 605525
UniProt ID: Q9H211
Chromosome Location: 16q24.3
Pathway: Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem;
Function: DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.