Recombinant Human CDT1 protein, GST-tagged
| Cat.No. : | CDT1-105H |
| Product Overview : | Recombinant Human CDT1(1 a.a. - 546 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 546 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 86.46 kDa |
| AA Sequence : | MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVD EVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGES CTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQD MMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRM EKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQR LERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDK AADLAHITARLAHQTRAEEGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ] |
| Official Symbol | CDT1 |
| Synonyms | CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2; Double parked, Drosophila, homolog of; |
| Gene ID | 81620 |
| mRNA Refseq | NM_030928 |
| Protein Refseq | NP_112190 |
| MIM | 605525 |
| UniProt ID | Q9H211 |
| Chromosome Location | 16q24.3 |
| Pathway | Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; |
| Function | DNA binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CDT1-7604H | Recombinant Human CDT1 protein, MYC/DDK-tagged | +Inquiry |
| CDT1-27915TH | Recombinant Human CDT1, His-tagged | +Inquiry |
| CDT1-1550M | Recombinant Mouse CDT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDT1-3240M | Recombinant Mouse CDT1 Protein | +Inquiry |
| CDT1-105H | Recombinant Human CDT1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDT1-7604HCL | Recombinant Human CDT1 293 Cell Lysate | +Inquiry |
| CDT1-106HKCL | Human CDT1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDT1 Products
Required fields are marked with *
My Review for All CDT1 Products
Required fields are marked with *



