Recombinant Human CDT1 protein, GST-tagged
| Cat.No. : | CDT1-105H | 
| Product Overview : | Recombinant Human CDT1(1 a.a. - 546 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Protein Length : | 1 a.a. - 546 a.a. | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 86.46 kDa | 
| AA Sequence : | MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVD EVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGES CTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQD MMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRM EKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQR LERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDK AADLAHITARLAHQTRAEEGL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Gene Name | CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ] | 
| Official Symbol | CDT1 | 
| Synonyms | CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2; Double parked, Drosophila, homolog of; | 
| Gene ID | 81620 | 
| mRNA Refseq | NM_030928 | 
| Protein Refseq | NP_112190 | 
| MIM | 605525 | 
| UniProt ID | Q9H211 | 
| Chromosome Location | 16q24.3 | 
| Pathway | Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; | 
| Function | DNA binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| CDT1-7604H | Recombinant Human CDT1 protein, MYC/DDK-tagged | +Inquiry | 
| CDT1-1550M | Recombinant Mouse CDT1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CDT1-11073H | Recombinant Human CDT1, GST-tagged | +Inquiry | 
| CDT1-575HF | Recombinant Full Length Human CDT1 Protein, GST-tagged | +Inquiry | 
| CDT1-3240M | Recombinant Mouse CDT1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CDT1-7604HCL | Recombinant Human CDT1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDT1 Products
Required fields are marked with *
My Review for All CDT1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            