"CD40" Related Products

Expand
Expand

Recombinant Human CD40, Fc Chimera

Cat. No.: CD40-493H
Product Overview: Recombinant Human CD40 encoding the signal peptide and extracellular domain of human CD40 (aa 1-193) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedHuman 293 cells.
Description: CD40 (TNFRSF5, CD40L Receptor) is a type I membrane protein and a member of the TNF receptor family. CD40 is expressed on B cells, monocytes, dendritic cells, endothelial cells, epithelial cells and B cell lymphomas and carcinomas. CD40 activates mulitple signalling pathways and can promote cell survival through up-regulation of the expression of genes encoding anti-apoptopic proteins.
Source: Human 293 cells.
Amino Acid Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Under reducing conditions CD40 (173aa) – Fc Chimera migrates as a broad band between 50 and 65 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation.
pI: CD40 (173aa) – Fc Chimera separates into a number of glycoforms with an observed pI between 5.5 and 9.0 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: Purified CD40 (173aa) - Fc Chimera consists of 5 to 30% carbohydrate by weight.
Glycosylation: CD40 (173aa) – Fc Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C.
Activity: The ED50of CD40 (173aa) – Fc Chimera is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.
Gene Name: CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens ]
Synonyms: CD40; CD40 molecule, TNF receptor superfamily member 5; p50; Bp50; CDW40; MGC9013; TNFRSF5; CD40 antigen; CD40 type II isoform; CD40L receptor; B cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); nerve growth factor receptor-related B-lymphocyte activation molecule; tumor necrosis factor receptor superfamily, member 5;B-cell surface antigen CD40; OTTHUMP00000031699; OTTHUMP 00000031700
Gene ID: 958
mRNA Refseq: NM_001250
Protein Refseq: NP_001241
UniProt ID: P25942
Chromosome Location: 20q12-q13.2
MIM: 109535
Pathway: ograft rejection; Autoimmune thyroid disease; Cell adhesion molecules (CAMs); Cytokine-cytokine receptor interaction; Primary immunodeficiency; Systemic lupus erythematosus; Toll-like receptor signaling pathway; Signaling in Immune system
Function: enzyme binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.