"CD40" Related Products

Expand
Expand

Recombinant Human CD40, Fc Chimera

Cat. No.: CD40-493H
Product Overview: Recombinant Human CD40 encoding the signal peptide and extracellular domain of human CD40 (aa 1-193) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedHuman 293 cells.
Description: CD40 (TNFRSF5, CD40L Receptor) is a type I membrane protein and a member of the TNF receptor family. CD40 is expressed on B cells, monocytes, dendritic cells, endothelial cells, epithelial cells and B cell lymphomas and carcinomas. CD40 activates mulitple signalling pathways and can promote cell survival through up-regulation of the expression of genes encoding anti-apoptopic proteins.
Source: Human 293 cells.
Amino Acid Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Under reducing conditions CD40 (173aa) – Fc Chimera migrates as a broad band between 50 and 65 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation.
pI: CD40 (173aa) – Fc Chimera separates into a number of glycoforms with an observed pI between 5.5 and 9.0 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: Purified CD40 (173aa) - Fc Chimera consists of 5 to 30% carbohydrate by weight.
Glycosylation: CD40 (173aa) – Fc Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C.
Activity: The ED50of CD40 (173aa) – Fc Chimera is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.
Gene Name: CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens ]
Synonyms: CD40; CD40 molecule, TNF receptor superfamily member 5; p50; Bp50; CDW40; MGC9013; TNFRSF5; CD40 antigen; CD40 type II isoform; CD40L receptor; B cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); nerve growth factor receptor-related B-lymphocyte activation molecule; tumor necrosis factor receptor superfamily, member 5;B-cell surface antigen CD40; OTTHUMP00000031699; OTTHUMP 00000031700
Gene ID: 958
mRNA Refseq: NM_001250
Protein Refseq: NP_001241
UniProt ID: P25942
Chromosome Location: 20q12-q13.2
MIM: 109535
Pathway: ograft rejection; Autoimmune thyroid disease; Cell adhesion molecules (CAMs); Cytokine-cytokine receptor interaction; Primary immunodeficiency; Systemic lupus erythematosus; Toll-like receptor signaling pathway; Signaling in Immune system
Function: enzyme binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.