Recombinant Pig CD40 protein, His-tagged
| Cat.No. : | CD40-422P |
| Product Overview : | Recombinant Pig CD40 protein(Q8SQ34)(21-194aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-194a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECLPCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCTLHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTNKTDVVCGFQSRMRA |
| Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Sus scrofa ] |
| Official Symbol | CD40 |
| Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; tumor necrosis factor receptor superfamily member 5; CD40L receptor; B-cell surface antigen CD40; TNFRSF5; |
| Gene ID | 397395 |
| mRNA Refseq | NM_214194 |
| Protein Refseq | NP_999359 |
| ◆ Recombinant Proteins | ||
| CD40-8823C | Recombinant Cynomolgus CD40 protein, His-tagged | +Inquiry |
| CD40-167CAF488 | Recombinant Canine CD40 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CD40-8824CAF555 | Recombinant Monkey CD40 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Cd40-325MAF647 | Recombinant Mouse CD40 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD40-1088M | Recombinant Mouse CD40 protein(Met1-Arg193), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
| CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
| CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
| CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
| CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *



