Recombinant Pig CD40 protein, His-tagged

• Cat.No.: CD40-422P
• Product Overview: Recombinant Pig CD40 protein(Q8SQ34)(21-194aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: His
• Protein Length: 21-194a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: EPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECLPCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCTLHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTNKTDVVCGFQSRMRA

Gene Information

• Gene Name: CD40 CD40 molecule, TNF receptor superfamily member 5 [ Sus scrofa ]
• Official Symbol: CD40
• Synonyms: CD40; CD40 molecule, TNF receptor superfamily member 5; tumor necrosis factor receptor superfamily member 5; CD40L receptor; B-cell surface antigen CD40; TNFRSF5
• Gene ID: 397395
• mRNA Refseq: NM_214194
• Protein Refseq: NP_999359