Recombinant Pig CD40 protein, His-tagged
Cat.No. : | CD40-422P |
Product Overview : | Recombinant Pig CD40 protein(Q8SQ34)(21-194aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-194a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECLPCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCTLHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTNKTDVVCGFQSRMRA |
Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Sus scrofa ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; tumor necrosis factor receptor superfamily member 5; CD40L receptor; B-cell surface antigen CD40; TNFRSF5; |
Gene ID | 397395 |
mRNA Refseq | NM_214194 |
Protein Refseq | NP_999359 |
◆ Recombinant Proteins | ||
CD40-6231C | Recombinant Chicken CD40 | +Inquiry |
CD40-165C | Recombinant Canine CD40, His-tagged | +Inquiry |
CD40-105H | Active Recombinant Human CD40, MIgG2a Fc-tagged | +Inquiry |
CD40-174HF | Recombinant Human CD40 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
Cd40-4981M | Active Recombinant Mouse CD40 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *