"CSF3" Related Products

Recombinant Human Colony Stimulating Factor 3 (Granulocyte)

Cat. No. : CSF3-142H
Product Overview : Recombinant Human Colony Stimulating Factor 3 (Granulocyte) encoding the human Colony Stimulating Factor 3 (Granulocyte) protein sequence (containing the signal peptide sequence, and the mature G-CSF sequence) was expressed in modifiedhuman 293 cells.
Description : Granulocyte colony stimulating factor (G-CSF) is the primary extracellular regulator of granulopoiesis and regulates the production of neutrophils by stimulating proliferation and survival of specific bone marrow precursor cells and their differentiation into granulocytes. Neutrophils play a critical role in the defence against bacterial and fungal infections. G-CSF is produced by monocytes, macrophages, neutrophils, fibroblasts and endothelial cells and is capable of increasing the absolute number of circulating neutrophils and enhancing their antimicrobial function. Unlike GMCSF, the activity of G-CSF is not species specific. Additionally, G-CSF production is inducible by cytokines including TNF-alpha, IL-1, GM-CSF, IL-17 and IL-4.
Source : Human 293 cells.
Amino Acid Sequence : TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP.
Molecular Mass : G-CSF migrates as a band between 15 and 20 kDa in SDS-PAGE. This compares with the predicted molecular mass of 18.7 kDa.
pI : G-CSF separates into a number of isoforms with a pI between 5.4 and 6.0 in 2D PAGE Due to post-translational modifications, in particular glycosylation.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50of G-CSF is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
Gene Name : CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
Synonyms : CSF3; colony stimulating factor 3 (granulocyte); GCSF; G-CSF; MGC45931; colony stimulating factor 3; filgrastim; lenograstim; pluripoietin; granulocyte colony stimulating factor; Granulocyte colony-sti mulating factor; OTTHUMP00000164327
Gene ID : 1440
mRNA Refseq : NM_000759
Protein Refseq : NP_000750
UniProt ID : P09919
Chromosome Location : q11.2-q12
MIM : 138970
Pathway : Cytokine-cytokine receptor interaction; opoietic cell lineage; Jak-STAT signaling pathway
Function : cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.