"IFNG" Related Products

Recombinant Human Interferon, Gamma

Cat. No.: IFNG-26H
Product Overview: Recombinant Human Interferon encoding the full-length human Interferon-gamma (IFN-g) protein was expressed in modifiedhuman 293 cells.
Description: Interferon-gamma (IFN-gamma) is a type II interferon and is expressed predominantly by CD8+ and CD4+ T cells, and natural killer (NK) cells. IFN-gamma acts as a potent activator of antigen presenting cells as well as inducing expression of IL-12, which in turn promotes a TH1 cell mediated immune response for clearing of viral and microbial infections. IFN-gamma activates non-specific tumoricidal activity in macrophages in addition to enhancing the cytotoxicity of NK cells. IFN-gamma can also directly inhibit proliferation of transformed cells or potentiate the antiviral and anti-tumor effects of the type I interferons.
Source: Human 293 cells.
Amino Acid Sequence: CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ.
Molecular Mass: IFN-gamma migrates as a band between 20 and 25 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IFN-gamma that has a predicted molecular mass of 17.1 kDa.
pI: IFN-gamma separates into a number of glycoforms with a pI between 6 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: IFN-gamma consists of 10-30% carbohydrate by weight.
Glycosylation: IFN-gamma has N-linked and possibly O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50 of IFN-gamma is typically 0.01 - 0.02 ng/ml as measured in a cell prolipheration assay using the human growth factor-dependant M-07e cell line.
Gene Name: IFNG interferon, gamma [ Homo sapiens ]
Synonyms: IFNG; interferon, gamma; IFG; IFI; IFN-gamma; Immune interferon; interferon, gamma
Gene ID: 3458
mRNA Refseq: NM_000619
Protein Refseq: NP_000610
UniProt ID: P01579
Chromosome Location: 12q14
MIM: 147570
Pathway: Allograft rejection; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Proteasome; Regulation of autophagy; Systemic lupus erythematosus; cell receptor signaling pathway; TGF-beta signaling pathway; Type I diabetes mellitus
Function: cytokine activity; interferon-gamma receptor binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.