"IL1RN" Related Products

Expand
Expand

Recombinant Human Interleukin 1 Receptor Antagonist

Cat. No.: IL1RN-115H
Product Overview: Recombinant Humaninterleukin1 receptor antagonist (IL-1ra) protein sequence (including the signal peptide sequence, and the mature human Interleukin-1 receptor antagonist sequence) was expressed in modifiedhuman 293 cells.
Description: IL-1 receptor antagonist (IL-1ra) is a naturally occurring protein that plays an important role in regulating the activity of IL-1 by competitively binding to the IL-1 receptor and thereby inhibiting IL-1 signaling activation in target cells. The expression of IL-1ra has been detected in bone marrow monocytes, macrophages, neutrophils and T cells.
Source: Human 293 cells.
Amino Acid Sequence: RPSGRKSSKM QAFRIW DVNQKT FYLRNN QLVAGY LQGPNVNLEE KIDVVPIEP ALFLGIH GGKMCLS CVKSGDET RLQLEA VNITDLSEN RKQDKRFAF IRSDSGPTT SFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE.
Molecular Mass: IL-1 receptor antagonist (IL-1ra) migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted molecular mass of 17.1 kDa.
pI: IL-1ra separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted pI of 5.4.
% Carbohydrate: Purified IL-1ra consists of 5-25% carbohydrate by weight.
Glycosylation: IL-1ra has N-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at –18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50of IL-1ra is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line.
Gene Name: IL1RN interleukin 1 receptor antagonist [ Homo sapiens ]
Synonyms: IL1RN; interleukin 1 receptor antagonist; DIRA; ICIL-1RA; IL-1ra3; IL1F3; IL1RA; IRAP; MGC10430; MVCD4; IL1RN (IL1F3); OTTHUMP00000203730; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); type II interleukin-1 receptor antagonist
Gene ID: 3557
mRNA Refseq: NM_000577
Protein Refseq: NP_000568
MIM: 147679
UniProt ID: P18510
Chromosome Location: 2q14.2
Function: cytokine activity; interleukin-1 receptor antagonist activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.