Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | IL1RN-3569H |
| Product Overview : | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Molecular Mass : | 17.9 kDa |
| AA Sequence : | MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ] |
| Official Symbol | IL1RN |
| Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
| Gene ID | 3557 |
| mRNA Refseq | NM_000577 |
| Protein Refseq | NP_000568 |
| MIM | 147679 |
| UniProt ID | P18510 |
| ◆ Recombinant Proteins | ||
| IL1RN-115H | Active Recombinant Human Interleukin 1 Receptor Antagonist | +Inquiry |
| Il1rn-107R | Recombinant Rat Il1rn, His-tagged | +Inquiry |
| Il1rn-546M | Recombinant Mouse Il1rn protein | +Inquiry |
| IL1RN-3569H | Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IL1RN-188H | Active Recombinant Human IL1RN protein(Arg26-Glu177) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
| IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
