"IL3RA" Related Products

Recombinant Human IL3RA, Fc Chimera

Cat. No.: IL3RA-121H
Product Overview: Recombinant Human interleukin 3 receptor, alpha (low affinity) encoding the signal peptide and extracellular domain of human Interleukin 3 receptor alpha chain (aa 1-18) was expressed in modifiedhuman 293 cells. Itwas fused to the Fc region of human IgG1 (aa 93-330).
Description: IL-3Ra is constitutively expressed on hematopoietic progenitor (CD34+) cells and mediates their proliferation and differentiation. It is also found on monocytes, neutrophils, basophils, eosinophils, megakaryocyte and erythroid precursors, mast cells, macrophages, a subpopulation of CD5+B-lymphocytes and some endothelial cells.
Source: Human 293 cells.
Amino Acid Sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNN SYC QFG AISL CE VTNYTVRVANPPFST WILFPENSGK PWAGAENLTC WIHDVDFLSC SWAV GPGAPA DVQ YDLYLN VANRRQQY ECLHYKTD AQGTRIGC RFDDISRLS SGSQSSHI LVRGRSAA FGIP CTDKF VV FSQIEILTP PNMTAKC NKTHSFM HWKMRS HFNRKFR YELQIQKR MQPVITEQ VR DRTSFQLL NPGTYTVQIR ARERVYEFLS AWSTPQRFE CDQEEGANT RGGRVDGIQ WIP KVDKKVEP KSCDKTHTCP PCPAPELLGGP SVFLFPPKPKD T L MIS RTP EVT CV VV DVSH EDPEVKFN WYVDGVEV HNAKTKPRE EQYNSTYRV VSVL TVLH QDWLNGKE YKC RVSNKA LPAPIEKTIS KAKGQPREP QVYTLPPSR DELTKNQVS LTC LVKGFYPS DIAV EWE S NGQPENN YKTTPPVL DSDGSFF LYSKLTVD KSRW Q QG NVFSCSV MHE ALHN HYTQ K SLSLSPGK.
Molecular Mass: IL-3 R alpha-Fc Chimera migrates as a broad band between 85 and 100 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-3 R alpha-Fc that has a predicted molecular mass of 60.6 kDa.
PI: IL-3 R alpha-Fc Chimera separates into a number of isoforms with a pI between 6.2 and 9.0 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-3 R alpha-Fc that has a predicted pI of 8.43.
% Carbohydrate: Purified IL-3 R alpha-Fc Chimera consists of 25-40% carbohydrate by weight.
Glycosylation: IL-3 R alpha-Fc Chimera has N-linked and possibly O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); RP11-261P4.2; CD123; IL3R; IL3RAY; IL3RX; IL3RY; MGC34174; hIL-3Ra; CD123 antigen; Interleukin-3 receptor; interleukin 3 receptor, alpha; IL-3R-alpha; OTTHUMP00000022828; MGC34174
Gene ID: 3563
mRNA Refseq: NM_002183
Protein Refseq: NP_002174
MIM: 308385
UniProt ID: P26951
Chromosome Location: Xp22.3 or Yp11.3
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Apoptosis; Hematopoietic cell lineage
Function: interleukin-3 receptor activity; receptor activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.