"VEGFA" Related Products

Recombinant Human VEGF165

Cat. No.: VEGFA-156H
Product Overview: Recombinant Human vascular endothelial growth factor A was expressed in modifiedhuman 293 cells.
Description: Vascular endothelial growth factor (VEGF) is a member of the cysteine-knot growth factor superfamily. Five VEGF splice variants exist including VEGF-121, VEGF-145, VEGF-165, VEGF-189; and VEGF-206. VEGF-165 is the most abundant and active isoform. VEGF-165 functions as a growth factor in angiogenesis, vasculogenesis and endothelial cell growth. VEGF-165 acts as a specific mitogen and survival factor for vascular endothelial cells, inducing microvascular permeability, cell migration and regulates the differentiation and survival of hematopoietic progenitor cells to affect hematopoiesis, immune function and tumour progression. VEGF-165 also plays roles in neurogenesis and blood brain barrier function.
Source: human 293 cells.
Theoretical Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMR CGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRA RQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR.
Molecular Mass: VEGF-165 migrates as a band between 15 and 25 kDa in SDS-PAGE. This compares with the predicted molecular mass of 19.2kDa.
PI: Unmodified human VEGF-165 has a predicted pI of 7.6.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Activity: The ED50of VEGF-165 is typically 0.2 - 2.0 ng/ml as measured in a cell proliferation assay using human umbilical vein endothelial (HUVEC) cells.
Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Synonyms: vascular endothelial growth factor A; VPF; VEGF; MVCD1; VEGF-A; MGC70609; VEGFA; vascular permeability factor; vascular endothelial growth factor isoform VEGF165; Vascular permeability factor
Gene ID: 7422
mRNA Refseq: NM_001025366
Protein Refseq: NP_001020537
MIM: 192240
UniProt ID: P15692
Chromosome Location: 6p12
Pathway: Bladder cancer; Cytokine-cytokine receptor interaction; Focal adhesion; Pancreatic cancer; Pathways in cancer; Renal cell carcinoma; VEGF signaling pathway; mTOR signaling pathway; Hemostasis; Signaling by VEGF
Function: cell surface binding; cytokine activity; extracellular matrix binding; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein homodimerization activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.