Recombinant Rat Vegfa protein, His-tagged
Cat.No. : | Vegfa-3752R |
Product Overview : | Recombinant Rat Vegfa protein(P16612)(27-214aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-214aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Vegfa vascular endothelial growth factor A [ Rattus norvegicus ] |
Official Symbol | Vegfa |
Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164; |
Gene ID | 83785 |
mRNA Refseq | NM_001110333 |
Protein Refseq | NP_001103803 |
◆ Recombinant Proteins | ||
VEGFA-51H | Active Recombinant Human VEGFA-121 Protein, Animal Free | +Inquiry |
Vegfa-36M | Active Recombinant Mouse Vegfa, His-tagged | +Inquiry |
VEGFA-536M | Recombinant Mouse VEGFA Protein | +Inquiry |
Vegfa-475MAF647 | Recombinant Mouse Vegfa Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Vegfa-165R | Recombinant Rat Vegfa protein, His/S-tagged | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vegfa Products
Required fields are marked with *
My Review for All Vegfa Products
Required fields are marked with *