"NTF4" Related Products

Expand

Recombinant Human NTF4 protein

Cat.No. : NTF4-16H
Product Overview : Recombinant Human NTF4 protein was expressed in Escherichia coli.
Description : NT-4 also named as NT-5 is a neuronal and epithelial grow factor belongs to the NGF-beta family. The NT-4 precursor is consisted of a 24 a.a. signal peptide, a 56 a.a. propertied and 130 a.a. NT-4. The mature protein has six Cys amino acid residues and has the relative structure with NT-3, BDNF (sharing about 48 % - 52 % sequence identity). Additionally, it shares 91 % and 95 % a.a. sequence identity with mouse and rat NT-4. NT-4 is mainly expressed in prostate and has low level thymus, placenta, and skeletal muscle. It can binding with the LNGFR and trkB receptors and plays a crucial role in the regulation of survival and the maintenance of peripheral sensory sympathetic neurons. Defect of NT-4 may cause primary open angle glaucoma type 1O.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 5.5.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
Molecular Mass : Approximately 28.1 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (262 total amino acid residues).
Protein length : 131
AA Sequence : MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Endotoxin : Less than 1 EU/μg of rHuNT-4 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of NTF4-16H :

Gene Name : NTF4
Official Symbol : NTF4
Synonyms : NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5;
Gene ID : 4909
mRNA Refseq : NM_006179
Protein Refseq : NP_006170
MIM : 162662
UniProt ID : P34130

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.