Recombinant Rat Ntf4 Protein, His-tagged
Cat.No. : | Ntf4-164R |
Product Overview : | Recombinant Rat Ntf4 Protein(NP_037316.2)(Gly80~Ala209) is expressed from E. coli with a His Tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Gly80~Ala209 |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose. |
Molecular Mass : | 18kDa(Analysis of differences refer to the manual) |
AA Sequence : | GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Concentration : | 200µg/mL |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | Ntf4 |
Official Symbol | Ntf4 |
Synonyms | NT5; NTF4; NT-4/5; Neurotrophic Factor 4; Neurotrophin-5 |
Gene ID | 25730 |
mRNA Refseq | NM_013184.3 |
Protein Refseq | NP_037316.2 |
UniProt ID | P34131 |
◆ Recombinant Proteins | ||
NTF4-16H | Recombinant Human NTF4 protein | +Inquiry |
NTF4-219H | Recombinant Human NTF4 Protein | +Inquiry |
NTF4-752H | Recombinant Human NTF4 protein, His & T7 (Accession# P34130)-tagged | +Inquiry |
NTF4-324N | Active Recombinant Human NTF4 Protein (131 aa) | +Inquiry |
NTF4-2933R | Recombinant Rhesus Macaque NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ntf4 Products
Required fields are marked with *
My Review for All Ntf4 Products
Required fields are marked with *
0
Inquiry Basket