Recombinant Rat Ntf4 Protein, His-tagged
| Cat.No. : | Ntf4-164R |
| Product Overview : | Recombinant Rat Ntf4 Protein(NP_037316.2)(Gly80~Ala209) is expressed from E. coli with a His Tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gly80~Ala209 |
| Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose. |
| Molecular Mass : | 18kDa(Analysis of differences refer to the manual) |
| AA Sequence : | GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA |
| Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
| Purity : | > 95% |
| Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
| Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
| Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Concentration : | 200µg/mL |
| Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Gene Name | Ntf4 |
| Official Symbol | Ntf4 |
| Synonyms | NT5; NTF4; NT-4/5; Neurotrophic Factor 4; Neurotrophin-5 |
| Gene ID | 25730 |
| mRNA Refseq | NM_013184.3 |
| Protein Refseq | NP_037316.2 |
| UniProt ID | P34131 |
| ◆ Recombinant Proteins | ||
| NTF4-2933R | Recombinant Rhesus Macaque NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NTF4-013H | Active Recombinant Human NTF4 | +Inquiry |
| NTF4-29H | Recombinant Human NTF4 | +Inquiry |
| NTF4-3760R | Recombinant Rat NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NTF4-324N | Active Recombinant Human NTF4 Protein (131 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ntf4 Products
Required fields are marked with *
My Review for All Ntf4 Products
Required fields are marked with *
